PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn049881
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 357aa    MW: 38726.6 Da    PI: 7.3273
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn049881genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.37.1e-13108152347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ I+r   + Rt+ q+ s+ qky
       Achn049881 108 PWTEEEHRLFLIGLQKLGKGDWRGISRSYVTSRTPTQVASHAQKY 152
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.102.1E-4228IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.137101157IPR017930Myb domain
SuperFamilySSF466895.91E-17103158IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-17104155IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.9E-10105151IPR009057Homeodomain-like
SMARTSM007172.5E-9105155IPR001005SANT/Myb domain
PfamPF002492.7E-10108152IPR001005SANT/Myb domain
CDDcd001671.53E-8108153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPS RGGGGGNCVK LFGVRLTDGS IIKKSASMGN LSAHYHSSSS  60
AAASPNPSSP SSDPIRDPIL VPDGYLSDDP GHATCSTNRR LERKKGVPWT EEEHRLFLIG  120
LQKLGKGDWR GISRSYVTSR TPTQVASHAQ KYFIRHSNAT RRKRRSSLFD MVPEMYYVVC  180
QGTDQPTVPE DQFMLPPSQA VDSDTINSLP SLKLSLSQEF EPMEATSDEK VEEPKEIATL  240
LGEIPASVPV FSAFLPVPFA LWPSNTAPTP EEEKVAETFH HQVLRPTPVI PKEPVNVDQL  300
VGMSKLNLGE AEMSHVEPSL SLNLLGAPSR PSAFQASTPA NKSDISEGKS NVIQGV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015902398.11e-152PREDICTED: uncharacterized protein LOC107435329
RefseqXP_015902404.11e-152PREDICTED: uncharacterized protein LOC107435334
TrEMBLV4SSM01e-152V4SSM0_9R
STRINGGLYMA13G43120.11e-147(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA117701922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.13e-93MYB_related family protein